PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462902608
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 472aa    MW: 53630 Da    PI: 8.615
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462902608genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.21.6e-144761894
               --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3 18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
               +p +f+ ++ +k e ++ ++l+ +sg++W+v l  +   ++  +t+GWkeFv ++  + g +++F++dg+sef+ vv
  462902608  4 IPQPFC-KYRKK-EHNRPVSLKGPSGNTWQVML--TSVEEGLGFTQGWKEFVGDHSFQPGYILMFTYDGHSEFSVVV 76
               8*****.77433.45557***************..99999999**************************99995544 PP

2B353.83.4e-172483241797
                E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                 +p +f++++   ++++k++tl d++g+ Wev++ y++ ++   +++GW eF+  n+L+e D++vF+l ++++   +v+++
  462902608 248 NIPCEFVRQYL--PQSGKKMTLWDPQGKPWEVQYVYNNERSIAAFSSGWGEFAVGNNLEEFDVCVFELLKEDN--IKVHIY 324
                59999999995..347789********************999*************************987444..477776 PP

3B352.68.6e-17345429897
                -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                +dv  + +  +p +f++e+    ++sk++tl d++g+ Wev++ y  +s    +++GW +F+  n+L+e D++vF+l ++++   +v+++
  462902608 345 EDVKDEVLDNIPSEFVREYLP--QTSKKMTLWDPQGKPWEVQYVYHERSV-AAFSGGWGKFAVGNNLEEFDVCVFELLKEDN--IKVHIY 429
                5555555557*********63..47889***************8877765.56899********************987444..477776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086314.029180IPR003340B3 DNA binding domain
SMARTSM010190.0017180IPR003340B3 DNA binding domain
SuperFamilySSF1019368.83E-16378IPR015300DNA-binding pseudobarrel domain
PfamPF023625.3E-12476IPR003340B3 DNA binding domain
CDDcd100171.28E-12478No hitNo description
Gene3DG3DSA:2.40.330.104.1E-15480IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.774232327IPR003340B3 DNA binding domain
SMARTSM010193.0E-9237327IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-22245325IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.94E-20247325IPR015300DNA-binding pseudobarrel domain
PfamPF023624.8E-15249325IPR003340B3 DNA binding domain
CDDcd100171.20E-20249325No hitNo description
PROSITE profilePS5086313.14338432IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-22342430IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.8E-13342432IPR003340B3 DNA binding domain
SuperFamilySSF1019361.31E-20354430IPR015300DNA-binding pseudobarrel domain
PfamPF023621.9E-14355430IPR003340B3 DNA binding domain
CDDcd100171.05E-19355430No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MEEIPQPFCK YRKKEHNRPV SLKGPSGNTW QVMLTSVEEG LGFTQGWKEF VGDHSFQPGY  60
ILMFTYDGHS EFSVVVLSNT GVDDTSALDA QPSEERVVQA EVEEGAQDTD AAGASEQEAS  120
ALPTVEGNEK TRKRVRQGMV KSPAPKRHLS VQKKPEKTKP KAFVDTTKAG SIFPDSNKVL  180
SRMLDEHSSY NKSQTISKNV PRVGKVVSKK LRQPVVISQR RQITEEEKAH ALKRASEFKS  240
KNPFTLQNIP CEFVRQYLPQ SGKKMTLWDP QGKPWEVQYV YNNERSIAAF SSGWGEFAVG  300
NNLEEFDVCV FELLKEDNIK VHIYRIVLQI TPLLRNKSIF ELSKEDVKDE VLDNIPSEFV  360
REYLPQTSKK MTLWDPQGKP WEVQYVYHER SVAAFSGGWG KFAVGNNLEE FDVCVFELLK  420
EDNIKVHIYR IVLQITPLLR NKSISSYEFV FLMKNLYSKS LQGAGCKLKG GS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.11e-115PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D21e-91Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0A9DCS31e-120A0A0A9DCS3_ARUDO; Uncharacterized protein
STRINGSi027380m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-26B3 family protein